Rabbit Polyclonal Anti-SMC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMC3 antibody: synthetic peptide directed towards the C terminal of human SMC3. Synthetic peptide located within the following region: GKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRV |
Rabbit Polyclonal Anti-SMC3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMC3 antibody: synthetic peptide directed towards the N terminal of human SMC3. Synthetic peptide located within the following region: KWDKMRRALEYTIYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDAR |
SMC3 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SMC3. |
Germany
Japan
United Kingdom
China
