Antibodies

View as table Download

Rabbit Polyclonal Anti-SMNDC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMNDC1 antibody: synthetic peptide directed towards the middle region of human SMNDC1. Synthetic peptide located within the following region: QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK

Rabbit Polyclonal Anti-SMNDC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMNDC1 antibody: synthetic peptide directed towards the C terminal of human SMNDC1. Synthetic peptide located within the following region: KGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

SMNDC1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 19~48 amino acids from the N-terminal region of human SMNDC1

SMNDC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SMNDC1

SMNDC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SMNDC1

SMNDC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-238 of human SMNDC1 (NP_005862.1).
Modifications Unmodified