Antibodies

Jump to Filters
View as table Download
SMPDL3B Rabbit Polyclonal Antibody
TA334676

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMPDL3B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMPDL3B antibody: synthetic peptide directed towards the N terminal of human SMPDL3B. Synthetic peptide located within the following region: ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
SMPDL3B Rabbit Polyclonal Antibody
TA310131

USD 230.00

3 Weeks

Rabbit anti-SMPDL3B polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH