Rabbit Polyclonal Anti-SMU1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMU1 antibody: synthetic peptide directed towards the N terminal of human SMU1. Synthetic peptide located within the following region: KQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQALAGEVSVV |
Rabbit Polyclonal Anti-SMU1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMU1 antibody is: synthetic peptide directed towards the N-terminal region of Human SMU1. Synthetic peptide located within the following region: TDPMIMLKQTQPERYIHLENLLARSYFDPREAYPDGSSKEKRRAAIAQAL |
SMU1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SMU1 |
SMU1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SMU1 (NP_060695.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China