Antibodies

View as table Download

SNAIL (SNAI1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from human SNAI 1 around the phosphorylation site of Serine 246.

Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SNAI1

Rabbit polyclonal SNAI1 (Ser246) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human: Ser246, Mouse: Ser246
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M).
Modifications Phospho-specific

Rabbit Polyclonal Antibody against SNAI1 (N-term R8)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SNAI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human SNAI1.

Rabbit anti-Snail Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Snail

Rabbit Polyclonal SNAI1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SNAI1

SNAIL (SNAI1) pSer246 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

Rabbit polyclonal anti-SNAI1 (Ab-246) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human SNAI1 around the phosphorylation site of serine 246 (T-F-SP-R-M)

Rabbit Polyclonal SNAI1 (Ser246) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SNAI1 around the phosphorylation site of Serine 246
Modifications Phospho-specific

SNAIL (SNAI1) mouse monoclonal antibody, clone AT2D5, Purified

Applications ELISA, WB
Reactivities Human

SNAIL (SNAI1) mouse monoclonal antibody, clone AT2D5, Purified

Applications ELISA, WB
Reactivities Human

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNAI1 Antibody: synthetic peptide directed towards the N terminal of human SNAI1. Synthetic peptide located within the following region: MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEIL

Rabbit Polyclonal Anti-SNAI1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNAI1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SNAI1. Synthetic peptide located within the following region: RKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLP

Rabbit Polyclonal Snail Antibody

Applications WB
Reactivities Human, Mouse, Canine, Equine
Conjugation Unconjugated
Immunogen A portion of amino acids 80-130 of human SNAI1 was used as the immunogen

Mouse monoclonal Anti-SNAIL1 Clone 20C8

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SNAI1 mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SNAI1 mouse monoclonal antibody, clone OTI10D7 (formerly 10D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SNAI1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human SNAI1

Snail Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human Snail (NP_005976.2).
Modifications Unmodified

Snail Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Snail (NP_005976.2).
Modifications Unmodified

Snail Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Snail (NP_005976.2).
Modifications Unmodified

SNAI1 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human SNAI1. AA range:215-264

Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI5E12 (formerly 5E12)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI10D7 (formerly 10D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SNAI1 (SNAIL) mouse monoclonal antibody, clone OTI10D7 (formerly 10D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SNAI1 mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated