Antibodies

Jump to Filters
View as table Download
SNRNP40 Rabbit Polyclonal Antibody
TA332086

USD 375.00

5 Days

Rabbit Polyclonal Anti-SNRNP40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNRNP40 Antibody is: synthetic peptide directed towards the middle region of Human SNRNP40. Synthetic peptide located within the following region: SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGT
SNRNP40 Rabbit Polyclonal Antibody
TA381837

USD 220.00

3 Weeks

SNRNP40 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SNRNP40.