Rabbit Polyclonal Anti-SNRPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the middle region of human SNRPD2. Synthetic peptide located within the following region: ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG |
Rabbit Polyclonal Anti-SNRPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the N terminal of human SNRPD2. Synthetic peptide located within the following region: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK |
SNRPD2 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human SNRPD2 |
SNRPD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human SNRPD2 (NP_004588.1). |
| Modifications | Unmodified |
SNRPD2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human SNRPD2 (NP_004588.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
