Antibodies

View as table Download

Rabbit Polyclonal Anti-SNRPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the middle region of human SNRPD2. Synthetic peptide located within the following region: ENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAG

Rabbit Polyclonal Anti-SNRPD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the N terminal of human SNRPD2. Synthetic peptide located within the following region: MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNK

SNRPD2 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human SNRPD2

SNRPD2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human SNRPD2 (NP_004588.1).
Modifications Unmodified

SNRPD2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-118 of human SNRPD2 (NP_004588.1).
Modifications Unmodified