Rabbit Polyclonal Anti-SNTB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SNTB1 Antibody: synthetic peptide directed towards the N terminal of human SNTB1. Synthetic peptide located within the following region: GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL |
SNTB1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SNTB1 |
SNTB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SNTB1 (NP_066301.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
