Antibodies

View as table Download

Goat Anti-SOCS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DAGRKPKLTRTQS, from the internal region of the protein sequence according to NP_055413.1.

Rabbit Polyclonal Anti-SOCS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOCS7 Antibody: synthetic peptide directed towards the N terminal of human SOCS7. Synthetic peptide located within the following region: LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP

Rabbit Polyclonal Anti-SOCS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOCS7 Antibody is: synthetic peptide directed towards the N-terminal region of Human SOCS7. Synthetic peptide located within the following region: GSAGRELDAGRKPKLTRTQSAFSPVSFSPLFTGETVSLVDVDISQRGLTS

Anti-SOCS7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 6-20 amino acids of human suppressor of cytokine signaling 7

Anti-SOCS7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 6-20 amino acids of human suppressor of cytokine signaling 7