Rabbit polyclonal SORBS1 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Hamster (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This SORBS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 866-892 amino acids from the Central region of human SORBS1. |
Goat Polyclonal Antibody against SORBS1
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1. |
Rabbit Polyclonal Anti-Sorbs1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Sorbs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sorbs1. Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC |
SORBS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SORBS1 |
SORBS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SRBS1 |
Germany
Japan
United Kingdom
China
