Antibodies

View as table Download

Rabbit polyclonal SORBS1 Antibody (Center)

Applications IF, WB
Reactivities Human, Hamster (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This SORBS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 866-892 amino acids from the Central region of human SORBS1.

Goat Polyclonal Antibody against SORBS1

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1.

Rabbit Polyclonal Anti-Sorbs1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Sorbs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sorbs1. Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC

SORBS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SORBS1

SORBS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human SRBS1