Antibodies

Jump to Filters
View as table Download
Sostdc1 Rabbit Polyclonal Antibody
TA337974

USD 375.00

5 Days

Rabbit Polyclonal Anti-Sostdc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sostdc1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sostdc1. Synthetic peptide located within the following region: EWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNF
SOSTDC1 Rabbit Polyclonal Antibody
TA358666

USD 360.00

5 Days

SOSTDC1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated