Antibodies

Jump to Filters
View as table Download
ANKRD58 (SOWAHD) (C-term) Rabbit Polyclonal Antibody
AP50189PU-N

USD 450.00

2 Weeks

ANKRD58 (SOWAHD) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 203-233 amino acids from the C-terminal region of human ANKRD58
ANKRD58 (SOWAHD) Rabbit Polyclonal Antibody
TA334870

USD 375.00

5 Days

Rabbit Polyclonal Anti-SOWAHD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOWAHD antibody is: synthetic peptide directed towards the C-terminal region of Human SOWAHD. Synthetic peptide located within the following region: NLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSL