Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-SP7 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SP7 antibody: synthetic peptide directed towards the C terminal of human SP7. Synthetic peptide located within the following region: RTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSP |
Rabbit Polyclonal Anti-SP7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SP7 antibody: synthetic peptide directed towards the N terminal of human SP7. Synthetic peptide located within the following region: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSV |
Rabbit Polyclonal anti-SP7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SP7 antibody: synthetic peptide directed towards the C terminal of human SP7. Synthetic peptide located within the following region: RTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSP |
Rabbit Polyclonal Anti-Sp7 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Sp7 antibody is: synthetic peptide directed towards the N-terminal region of Rat Sp7. Synthetic peptide located within the following region: MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSST |
SP7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SP7 |
SP7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SP7. |
Active filters
Target Symbol
- SP7