Antibodies

Jump to Filters
View as table Download
Spaca9 Rabbit Polyclonal Antibody
TA335447

USD 375.00

5 Days

Rabbit Polyclonal Anti-1700026L06Rik Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-1700026L06Rik Antibody is: synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik. Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI
Spaca9 Rabbit Polyclonal Antibody
TA357139

USD 360.00

5 Days

SPACA9 Antibody - N-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated