Rabbit Polyclonal Anti-SPAG6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPAG6 Antibody: synthetic peptide directed towards the middle region of human SPAG6. Synthetic peptide located within the following region: LQKCTYLPALEPFLYDAPPNILKHVVGQFSKVLFPWIFRYTSAEGGQLST |
Rabbit Polyclonal Anti-SPAG6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPAG6 Antibody: synthetic peptide directed towards the middle region of human SPAG6. Synthetic peptide located within the following region: HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC |
Rabbit Polyclonal Anti-SPAG6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SPAG6 |
Germany
Japan
United Kingdom
China
