Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Spata6 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Spata6 Antibody is: synthetic peptide directed towards the C-terminal region of Rat Spata6. Synthetic peptide located within the following region: RVKDVLKSHQAHGRHLCEERDPEKEDELELKRSLLYRDSAYDSDPEYSSF |
Rabbit Polyclonal Anti-SPATA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPATA6 Antibody: synthetic peptide directed towards the middle region of human SPATA6. Synthetic peptide located within the following region: SQKKKSKSPERSKYCINAKNYEQPTISSKSHSPSPYTKRRMCELSEDTRR |
Anti-SPATA6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-321 amino acids of human spermatogenesis associated 6 |
Active filters
Target Symbol
- SPATA6