Antibodies

Jump to Filters
View as table Download
SPEM1 (Center) Rabbit Polyclonal Antibody
AP54014PU-N

USD 450.00

2 Weeks

SPEM1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 114-144 amino acids from the Central region of Human SPEM1
SPEM1 Rabbit Polyclonal Antibody
TA333335

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPEM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPEM1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SPEM1. Synthetic peptide located within the following region: KSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTRC