Antibodies

Jump to Filters
View as table Download
Sprouty 1 (SPRY1) Goat Polyclonal Antibody
TA305701

USD 375.00

In Stock

Goat Anti-Sprouty Antibody

Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CPSRGQGKPS, from the C Terminus of the protein sequence according to NP_005832.1; NP_955359.1.
Sprouty 1 (SPRY1) Rabbit Polyclonal Antibody
TA339691

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPRY1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-SPRY1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPRY1. Synthetic peptide located within the following region: PTAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPRQEKHERTHEIIPIN
Sprouty 1 (SPRY1) Rabbit Polyclonal Antibody
TA381964

USD 220.00

3 Weeks

SPRY1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SPRY1 (NP_005832.1).
Modifications Unmodified