Rabbit Polyclonal Anti-SPSB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPSB1 antibody is: synthetic peptide directed towards the middle region of Human SPSB1. Synthetic peptide located within the following region: RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL |
SPSB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SPSB1 |
| Modifications | Unmodified |
SPSB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human SPSB1 (NP_079382.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China