Antibodies

Jump to Filters
View as table Download
Sra1 Rabbit Polyclonal Antibody
TA329929

USD 375.00

5 Days

Rabbit Polyclonal Anti-Sra1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sra1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT
SRA1 Rabbit Polyclonal Antibody
TA357930

USD 360.00

5 Days

SRA1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated