Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal SREBF2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SREBF2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 399-427 amino acids from the Central region of human SREBF2. |
Rabbit Polyclonal Anti-SREBF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIEL |
Rabbit Polyclonal Anti-SREBF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL |
Carrier-free (BSA/glycerol-free) SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-SREBF2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 407-421 amino acids of human sterol regulatory element binding transcription factor 2 |
SREBP2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SREBF2 (NP_004590.2). |
| Modifications | Unmodified |
SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SREBF2