Rabbit polyclonal Anti-SFRS12IP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS12IP1 antibody: synthetic peptide directed towards the N terminal of human SFRS12IP1. Synthetic peptide located within the following region: GYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEK |
Rabbit polyclonal Anti-SFRS12IP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS12IP1 antibody: synthetic peptide directed towards the middle region of human SFRS12IP1. Synthetic peptide located within the following region: NEEEEKKKEKSKEKIKLKKKRKRSYSSSSTEEDTSKQKKQKYQKKEKKKE |
SREK1IP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SREK1IP1. |
Germany
Japan
United Kingdom
China