Antibodies

View as table Download

Rabbit Polyclonal Anti-SRP54 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SRP54 antibody: synthetic peptide directed towards the middle region of human SRP54. Synthetic peptide located within the following region: ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

SRP54 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

Rabbit Polyclonal Anti-SRP54 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SRP54

SRP54 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SRP54

SRP54 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 196-455 of human SRP54 (NP_001139754.1).
Modifications Unmodified