Antibodies

Jump to Filters
View as table Download
SRSF6 Rabbit Polyclonal Antibody
TA345950

USD 475.00

5 Days

Rabbit Polyclonal Anti-SFRS6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS6 antibody: synthetic peptide directed towards the middle region of human SFRS6. Synthetic peptide located within the following region: KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS
SRSF6 Rabbit Polyclonal Antibody
TA382020

USD 220.00

3 Weeks

SRSF6 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SRSF6 (NP_006266.2).
Modifications Unmodified