Antibodies

Jump to Filters
View as table Download
ST3GAL5 Rabbit Polyclonal Antibody
TA339387

USD 310.00

5 Days

Rabbit Polyclonal Anti-ST3GAL5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST3GAL5 antibody: synthetic peptide directed towards the N terminal of human ST3GAL5. Synthetic peptide located within the following region: DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
ST3GAL5 Rabbit Polyclonal Antibody
TA382063

USD 220.00

3 Weeks

ST3GAL5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-200 of human ST3GAL5 (NP_003887.3).
Modifications Unmodified