Antibodies

View as table Download

ST8SIA6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 137-167 amino acids from the Central region of Human ST8SIA6

Rabbit Polyclonal Anti-ST8SIA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ST8SIA6 Antibody: synthetic peptide directed towards the middle region of human ST8SIA6. Synthetic peptide located within the following region: LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK