Antibodies

Jump to Filters
View as table Download
ST8SIA6 (Center) Rabbit Polyclonal Antibody
AP54061PU-N

USD 450.00

2 Weeks

ST8SIA6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 137-167 amino acids from the Central region of Human ST8SIA6
ST8SIA6 Rabbit Polyclonal Antibody
TA336178

USD 375.00

5 Days

Rabbit Polyclonal Anti-ST8SIA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ST8SIA6 Antibody: synthetic peptide directed towards the middle region of human ST8SIA6. Synthetic peptide located within the following region: LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK