Rabbit Polyclonal Anti-STAU1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAU1 antibody: synthetic peptide directed towards the N terminal of human STAU1. Synthetic peptide located within the following region: LSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEEN |
Rabbit Polyclonal Anti-STAU1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAU1 antibody: synthetic peptide directed towards the N terminal of human STAU1. Synthetic peptide located within the following region: SQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPI |
Rabbit Polyclonal Anti-STAU1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAU1 antibody: synthetic peptide directed towards the N terminal of human STAU1. Synthetic peptide located within the following region: PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG |
Rabbit Polyclonal Anti-STAU1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAU1 antibody: synthetic peptide directed towards the N terminal of human STAU1. Synthetic peptide located within the following region: NFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELK |
Carrier-free (BSA/glycerol-free) STAU1 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Staufen Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 426-577 of human Staufen (NP_059347.2). |
| Modifications | Unmodified |
Staufen Rabbit polyclonal Antibody
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Staufen |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
STAU1 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
STAU1 mouse monoclonal antibody,clone OTI4E6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
STAU1 mouse monoclonal antibody,clone OTI4E6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
STAU1 mouse monoclonal antibody,clone OTI4E6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
