STK33 mouse monoclonal antibody, clone 3F10
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
STK33 mouse monoclonal antibody, clone 3F10
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit polyclonal anti-STK33 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human STK33. |
Rabbit Polyclonal STK33 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human Stk33 (within residues 1-150). [Swiss-Prot Q9BYT3] |
STK33 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 38-68 amino acids from the N-terminal region of human STK33 |
Rabbit Polyclonal Anti-STK33 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the C-terminal region of Human STK33. Synthetic peptide located within the following region: NVLEMMKEWKNNPESVEENTTEEKNKPSTEEKLKSYQPWGNVPDANYTSD |
Rabbit Polyclonal Anti-STK33 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-STK33 antibody is: synthetic peptide directed towards the N-terminal region of Human STK33. Synthetic peptide located within the following region: VPPVLVVEMSQTSSIGSAESLISLERKKEKNINRDITSRKDLPSRTSNVE |
Rabbit Polyclonal Anti-STK33 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STK33 |
STK33 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STK33 |