Rabbit Polyclonal STOML3 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal STOML3 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-STOML3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STOML3 antibody: synthetic peptide directed towards the N terminal of human STOML3. Synthetic peptide located within the following region: SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC |
Rabbit Polyclonal Anti-STOML3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STOML3 antibody: synthetic peptide directed towards the middle region of human STOML3. Synthetic peptide located within the following region: LAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIK |