Antibodies

View as table Download

Rabbit Polyclonal STOML3 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Anti-STOML3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STOML3 antibody: synthetic peptide directed towards the N terminal of human STOML3. Synthetic peptide located within the following region: SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC

Rabbit Polyclonal Anti-STOML3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STOML3 antibody: synthetic peptide directed towards the middle region of human STOML3. Synthetic peptide located within the following region: LAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIK