Antibodies

Jump to Filters
View as table Download
STYK1 Rabbit Polyclonal Antibody
TA308663

USD 415.00

2 Weeks

Rabbit polyclonal antibody to STYK1 (serine/threonine/tyrosine kinase 1)

Applications IHC, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 214 and 422 of STYK1 (Uniprot ID#Q6J9G0)
STYK1 Rabbit Polyclonal Antibody
TA342380

USD 375.00

5 Days

Rabbit Polyclonal Anti-Styk1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Styk1 antibody is: synthetic peptide directed towards the middle region of Mouse Styk1. Synthetic peptide located within the following region: YHIGKQILLALEFLQEKHLFHGDVAARNILIQSDLTPKLCHLGLAYEVHA
STYK1 Rabbit Polyclonal Antibody
TA342379

USD 375.00

5 Days

Rabbit Polyclonal Anti-STYK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STYK1 antibody: synthetic peptide directed towards the C terminal of human STYK1. Synthetic peptide located within the following region: PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI
STYK1 Rabbit Polyclonal Antibody
TA351767

USD 345.00

In Stock

Rabbit Polyclonal Anti-STYK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human STYK1