Rabbit polyclonal anti-SUCNR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUCNR1. |
Rabbit polyclonal anti-SUCNR1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUCNR1. |
GPR91 (SUCNR1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 102-154 of Human GPR91. |
Rabbit Polyclonal Anti-SUCNR1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUCNR1 Antibody: A synthesized peptide derived from human SUCNR1 |
Rabbit Polyclonal Anti-SUCNR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUCNR1 antibody is: synthetic peptide directed towards the middle region of Human SUCNR1. Synthetic peptide located within the following region: INPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKI |
Rabbit Polyclonal Anti-SUCNR1 Antibody (Cytoplasmic Domain)
Applications | IHC |
Reactivities | Human |
Immunogen | SUCNR1 / GPR91 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human GPR91. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Dog, Bovine, Panda, Horse (88%). |
Rabbit Polyclonal Anti-SUCNR1 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SUCNR1 / GPR91 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human GPR91. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gorilla, Gibbon, Marmoset (94%). |
GPR91 Rabbit polyclonal Antibody
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human SUCNR1. AA range:100-149 |