Rabbit Polyclonal Anti-SYNE4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SYNE4 Antibody is: synthetic peptide directed towards the N-terminal region of Human SYNE4. Synthetic peptide located within the following region: PLGPRLGSEPLNHPPGAPREADIVGCTVCPASGEESTSPEQAQTLGQDSL |
Rabbit Polyclonal Anti-C19orf46 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C19orf46 Antibody: synthetic peptide directed towards the N terminal of human C19orf46. Synthetic peptide located within the following region: GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA |
Germany
Japan
United Kingdom
China