Antibodies

Jump to Filters
View as table Download
Synaptojanin 2 (SYNJ2) Rabbit Polyclonal Antibody
TA345863

USD 475.00

5 Days

Rabbit Polyclonal Anti-SYNJ2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYNJ2 antibody: synthetic peptide directed towards the N terminal of human SYNJ2. Synthetic peptide located within the following region: SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIAL