Rabbit Polyclonal Anti-SYT5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYT5 antibody: synthetic peptide directed towards the middle region of human SYT5. Synthetic peptide located within the following region: YLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDR |
Goat Anti-SYT5/ Synaptotagmin-5 (aa 80-93) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SYIDKVQPEIEELD, from the internal region of the protein sequence according to NP_058604.1. |
Anti-SYT5 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 46-200 amino acids of human synaptotagmin V |
SYT5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human SYT5 (NP_003171.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
