Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-FCRL1 (aa165-177) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FCRL1 (aa165-177) Antibody: Peptide with sequence C-TAEYEIPSVRESD, from the internal region of the protein sequence according to NP_443170.1; NP_001152869.1; NP_001152870.1. |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Goat Polyclonal Anti-SYVN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_115807.1; NP_757385.1 (HERQHLEARLQS) |
Rabbit Polyclonal Anti-SYVN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the middle region of human SYVN1. Synthetic peptide located within the following region: QGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAALSRPSGAA |
Rabbit Polyclonal Anti-SYVN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYVN1 antibody: synthetic peptide directed towards the C terminal of human SYVN1. Synthetic peptide located within the following region: ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV |
SYVN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human SYVN1 (NP_757385.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SYVN1