Antibodies

Jump to Filters
View as table Download
C1orf144 Rabbit Polyclonal Antibody
TA333801

USD 375.00

5 Days

Rabbit Polyclonal Anti-SZRD1 Antibody

Applications IF, WB
Reactivities Human
Immunogen The immunogen for Anti-SZRD1 Antibody: synthetic peptide directed towards the N terminal of human SZRD1. Synthetic peptide located within the following region: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN
C1orf144 (SZRD1) (N-term) Rabbit Polyclonal Antibody
AP50534PU-N

USD 450.00

2 Weeks

C1orf144 (SZRD1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 6-36 amino acids from the N-terminal region of human C1orf144
C1orf144 (SZRD1) Rabbit Polyclonal Antibody
TA360405

USD 360.00

5 Days

SZRD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C1orf144