Rabbit Polyclonal Anti-MAP3K7IP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K7IP2 antibody: synthetic peptide directed towards the N terminal of human MAP3K7IP2. Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG |
TAB2 (79-90) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Monkey, Rabbit |
| Immunogen | Synthetic peptide from positions 79-90 of human TAB2 (NP_055908.1) |
TAB2 (161-173) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide from positions 161-173 of human TAB2 (NP_055908.1) |
Rabbit Polyclonal TAB2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TAB2 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human TAB2. |
TAB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TAB2 |
TAB2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 350-693 of human TAB2 (NP_001278963.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
