Antibodies

View as table Download

Rabbit polyclonal anti-TAF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of human TAF1.

Rabbit polyclonal anti-TAF1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TAF1.

Rabbit Polyclonal Anti-TAF1 Antibody

Applications Assay, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Rabbit Polyclonal Anti-TAF1 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the middle region of human TAF1. Synthetic peptide located within the following region: MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEE

TAF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1860-1893 amino acids from the C-terminal region of human TAF1

TAF1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1630-1893 of human TAF1 (NP_004597.2).
Modifications Unmodified