Antibodies

Jump to Filters
View as table Download
TAS2R13 Rabbit Polyclonal Antibody
TA315430

USD 345.00

In Stock

Rabbit polyclonal anti-TAS2R13 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TAS2R13.
TAS2R13 Rabbit Polyclonal Antibody
TA331761

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAS2R13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R13 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R13. Synthetic peptide located within the following region: HIKDWLDRYERNTTWNFSMSDFETFSVSVKFTMTMFSLTPFTVAFISFLL