Antibodies

View as table Download

TAS2R7 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 207-235 amino acids from the C-terminal region of human TAS2R7

Rabbit Polyclonal Anti-TAS2R7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAS2R7 Antibody is: synthetic peptide directed towards the middle region of Human TAS2R7. Synthetic peptide located within the following region: DFRFCVKAKRKTNLTWSCRVNKTQHASTKLFLNLATLLPFCVCLMSFFLL