Rabbit Polyclonal Anti-TBC1D1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBC1D1 Antibody: synthetic peptide directed towards the middle region of human TBC1D1. Synthetic peptide located within the following region: RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW |
Rabbit Polyclonal TBC1D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TBC1D1 antibody was raised against a 22 amino acid synthetic peptide from near the carboxy terminus of human TBC1D1. The immunogen is located within the last 50 amino acids of TBC1D1. |
TBC1D1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 520-710 of human TBC1D1 (NP_055988.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
