Antibodies

Jump to Filters
View as table Download
TBC1D13 Rabbit Polyclonal Antibody
TA344293

USD 475.00

5 Days

Rabbit Polyclonal Anti-TBC1D13 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBC1D13 antibody: synthetic peptide directed towards the middle region of human TBC1D13. Synthetic peptide located within the following region: FLLLVCCAMLMLIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDS
TBC1D13 Rabbit Polyclonal Antibody
TA324444

USD 512.00

5 Days

Rabbit polyclonal TBC1D13 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This TBC1D13 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 76-105 amino acids from the Central region of human TBC1D13.
TBC1D13 Mouse Monoclonal Antibody [Clone ID: OTI2C5]
CF505791

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) TBC1D13 mouse monoclonal antibody,clone OTI2C5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TBC1D13 Mouse Monoclonal Antibody [Clone ID: OTI2C5]
TA505791

USD 379.00

In Stock

TBC1D13 mouse monoclonal antibody,clone OTI2C5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TBC1D13 Mouse Monoclonal Antibody [Clone ID: OTI2C5]
TA505791S

USD 159.00

2 Days

TBC1D13 mouse monoclonal antibody,clone OTI2C5

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated