Antibodies

View as table Download

Rabbit Polyclonal Anti-TBL1Y

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBL1Y antibody: synthetic peptide directed towards the middle region of human TBL1Y. Synthetic peptide located within the following region: LASGSFDKYVHIWNTQSGSLVHSYQGTGGIFEVCWNARGDKVGASASDGS

Rabbit Polyclonal Anti-TBL1Y Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TBL1Y