Goat Polyclonal Anti-TNNI3 (aa117-127) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TNNI3 (aa117-127) Antibody: Peptide with sequence C-KVTKNITEIAD, from the internal region of the protein sequence according to NP_000354.4. |
Goat Polyclonal Anti-TBP /Transcription factor IID (aa39-50) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBP /Transcription factor IID (aa39-50) Antibody: Peptide with sequence C-TPQPIQNTNSLS, from the internal region of the protein sequence according to NP_003185.1; NP_001165556.1. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
USD 450.00
In Stock
Rabbit Polyclonal antibody to TFIID (TATA box binding protein)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 158 and 339 of TFIID (Uniprot ID#P20226) |
Rabbit polyclonal anti-TBP antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TBP. |
TATA binding protein (TBP) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TBP |
Rabbit Polyclonal Anti-TBP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBP antibody: synthetic peptide directed towards the middle region of human TBP. Synthetic peptide located within the following region: FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD |
TBP Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TBP |
TBP rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
TBP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-319 of human TBP (NP_001165556.1). |
| Modifications | Unmodified |
TBP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBP (NP_001165556.1). |
| Modifications | Unmodified |
USD 380.00
4 Weeks
TATA Box Binding Protein (9D1) Mouse monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 380.00
4 Weeks
TATA Box Binding Protein (10C1) Mouse monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
