Rabbit Polyclonal Anti-Tbx18 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tbx18 antibody is: synthetic peptide directed towards the N-terminal region of RAT Tbx18. Synthetic peptide located within the following region: GPARSCTDAERSCASRGPAGSCEDGFLQGASPLASPGGSPKGSPVPGLAR |
Rabbit polyclonal anti-TBX18 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TBX18. |
Rabbit Polyclonal Anti-TBX18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX18 antibody: synthetic peptide directed towards the N terminal of human TBX18. Synthetic peptide located within the following region: QKKRRKLGAEEAAGAVDDGGCSRGGGAGEKGSSEGDEGAALPPPAGATSG |
Rabbit Polyclonal Anti-TBX18 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TBX18 |
TBX18 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TBX18 |
Tbx18 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
TBX18 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TBX18 |
Germany
Japan
United Kingdom
China
