Antibodies

View as table Download

Rabbit Polyclonal Anti-TBX19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBX19 antibody: synthetic peptide directed towards the N terminal of human TBX19. Synthetic peptide located within the following region: KPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTN

Rabbit Polyclonal Anti-TBX19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBX19 antibody: synthetic peptide directed towards the middle region of human TBX19. Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT

Carrier-free (BSA/glycerol-free) TBX19 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBX19 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

TBX19 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 229-448 of human TBX19 (NP_005140.1).
Modifications Unmodified

TBX19 (Tpit) mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

TBX19 (Tpit) mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated