Rabbit Polyclonal Anti-TBX2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX2 antibody: synthetic peptide directed towards the N terminal of human TBX2. Synthetic peptide located within the following region: EAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDDPKVTLEAKELWDQFHKL |
Rabbit Polyclonal Anti-TBX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX2 Antibody: synthetic peptide directed towards the middle region of human TBX2. Synthetic peptide located within the following region: AEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDE |
Anti-TBX2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 699-712 amino acids of Human T-box 2 |
TBX2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-470 of human TBX2 (NP_005985.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China