Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal TBX21 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBX21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of human TBX21. |
Rabbit Polyclonal Anti-TBX21 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the middle region of human TBX21. Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL |
Mouse Anti-T-bet Purified (25 ug)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Anti-Human/Mouse T-bet Purified (25 ug)
| Applications | WB |
| Reactivities | Human, Mouse, Rhesus |
| Conjugation | Unconjugated |
Rabbit Monoclonal T-bet Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TBX21 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the N terminal of human TBX21. Synthetic peptide located within the following region: FYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAG |
Rabbit Polyclonal Anti-Tbx21 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tbx21 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGIVEPGCGDMLTGTEPMPSDEGRGPGADQQHRFFYPEPGAQDPTDRRAG |
Rabbit Polyclonal Anti-TBX21 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21. Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG |
TBX21 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 326-535 of human TBX21 (NP_037483.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TBX21