Rabbit polyclonal TBX4 Antibody (N-term)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chicken, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This TBX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 103-129 amino acids from the N-terminal region of human TBX4. |
Rabbit Polyclonal Anti-TBX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBX4 antibody: synthetic peptide directed towards the middle region of human TBX4. Synthetic peptide located within the following region: LRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQALQHYQHE |
Rabbit Polyclonal Anti-Tbx4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tbx4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tbx4. Synthetic peptide located within the following region: DKGLSESEEAFRAPGPALGETSNSNNTNVPEPALATPGLSGTALSSPPGQ |
TBX4 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBX4 |
TBX4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 296-545 of human TBX4 (NP_060958.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China