Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TBX5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX5 Antibody: synthetic peptide directed towards the N terminal of human TBX5. Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT |
Rabbit Polyclonal Anti-TBX5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX5 Antibody: synthetic peptide directed towards the middle region of human TBX5. Synthetic peptide located within the following region: RMQSKEYPVVPRSTVRQKVASNHSPFSSESRALSTSSNLGSQYQCENGVS |
TBX5 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TBX5 |
Rabbit Polyclonal Anti-TBX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBX5 Antibody: synthetic peptide directed towards the N terminal of human TBX5. Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT |
Rabbit Polyclonal Anti-Tbx5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tbx5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tbx5. Synthetic peptide located within the following region: TDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEG |
Rabbit Polyclonal Anti-TBX5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TBX5 |
TBX5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human TBX5 (NP_852259.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TBX5